PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g11200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 325aa    MW: 37008.4 Da    PI: 6.8495
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g11200genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.27e-33182239259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp+vv++tYe++Hnh+
  Tp2g11200 182 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSYQDPTVVITTYESQHNHP 239
                8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381301.6E-1021325IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.801.0E-33166241IPR003657WRKY domain
SuperFamilySSF1182905.62E-29173241IPR003657WRKY domain
PROSITE profilePS5081132.282176241IPR003657WRKY domain
SMARTSM007746.1E-38181240IPR003657WRKY domain
PfamPF031062.1E-25182239IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0051607Biological Processdefense response to virus
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:1901002Biological Processpositive regulation of response to salt stress
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MSNEIKDLNN YHYTSSYNHY NNINSQNIMN LSYVSDPSTY NANMISSQIG SDLHSSPQGA  60
YGLGFELSPP STEFFNSSID QENGFYNAYN YKTSHQSHEV VGGGGAIVES ETRVSASPSS  120
SGADHHHGED SGKSMRKREA DDGGEDDQPS QKNVIKTKKK VEKKQREPRV SFMTKTEVDH  180
LEDGYRWRKY GQKAVKNSPY PRSYYRCTTQ KCNVKKRVER SYQDPTVVIT TYESQHNHPI  240
PTSRRTAMFS GPVTSDYSSS SLSPISDFII NTPRSFSHDD LFRAPYASVN VNPNYQQQQN  300
QEFHNESDYE LLKEMFPSVF FKQEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-28171241777Probable WRKY transcription factor 4
2lex_A2e-28171241777Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00545DAPTransfer from AT5G46350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9124180.0EU912418.1 Brassica napus WRKY8-1 transcription factor (WRKY8-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596685.10.0PREDICTED: probable WRKY transcription factor 8
RefseqXP_013704057.10.0PREDICTED: probable WRKY transcription factor 8
SwissprotQ9FL261e-173WRKY8_ARATH; Probable WRKY transcription factor 8
TrEMBLA0A0D3D9H00.0A0A0D3D9H0_BRAOL; Uncharacterized protein
STRINGBra025021.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46350.11e-143WRKY DNA-binding protein 8